PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009776474.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 962aa    MW: 105939 Da    PI: 6.1167
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009776474.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.55.2e-31727782359
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     ++rY eClkNhAas+Ggha+DGCgEfmps g egt+ alkC AC+CHRnFHR++  +
  XP_009776474.1 727 SIRYMECLKNHAASMGGHAIDGCGEFMPS-GGEGTPGALKCEACNCHRNFHRKKIIN 782
                     789*************************9.8899*******************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF141111.7E-6225304IPR025558Domain of unknown function DUF4283
PfamPF047701.1E-28728779IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257747.0E-20729780IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.4E-28729779IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.382730779IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 962 aa     Download sequence    Send to blast
MAASKMDIID SENQTKMKPD NHTAKVEGRD ETLGIMELDK NEHIGGGNEY GSKESEAAPK  60
NTHILEDGLY ISDSVDCVPE ATHSDSAERV ASPVNCSTAT SEIQASAETS CSGSSGLSFA  120
SDGIAGGIPS VMDDSSSMCS TDSMSFRGTY SNHNIQKLYG RGWKYGSKST SNAADWASEK  180
LNQPLDALPI GEHHEDRKSR PPIQVQYSTY RGRQAVTFPE NYWESLVPDC KLTLIGNFFQ  240
RKPRMKEIRA DFIAKNPLKG QVKITHYTSQ QVSLDFTNEA DYDTVLSKKT LTVAVMQISW  300
WSRDIHHEVG KQEWKAMDKE RDVKPGIMEQ QKTELDELIG GETEYKIDAP EAVLETPDIL  360
GEVSDVSNSL HIVPEVAHPD FRDNDASPVN CDTDTSKMHP SIGITCCQLS GISAPQNMID  420
GTSPYVMNVN SSKCSTYSIL SIVTTGLSSN DKDQSKSIRD VADSASKAHS QPLDDLPEAR  480
QQMLKKDVAV SHQSELTESD RERHSSEIPS VSSPPRSPPR SIGSVIQLMS KLKVSVTNDP  540
NSVKRSTSDN SNLTQKSVPL FNSAENAVLL SVDPHKSIEP KAIEKPLVRS ISITTENFPS  600
NQVTASATAE MPMPLLPTLP LLAHSVSPAA QLCADPPTAI DTYVPQSYPN GIVGSHIFGR  660
SEQAGSGSIF PSPSQALHQH SLAQRHSQLN SYKVDKNAHL DQESNMIAGP TQLQSLLTTS  720
VSDTTSSIRY MECLKNHAAS MGGHAIDGCG EFMPSGGEGT PGALKCEACN CHRNFHRKKI  780
INHRQMAGIG SHIEPRNNSN SRNIHKQSPI SQQYQHNYSY SPSSVVNSSD SYPQLPLPIS  840
GQICLPQGLE KKEPSLIRPS YSYEMVNHDT VQQWEYFWRD RSRNTSIDHP SLRNENQNFD  900
MFKPLNYRTS DNIPSEFANE FPHLDIINNL RYDEHGKGRT LMPNSGFQNL SNGSYHLNGH  960
FT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776474.10.0PREDICTED: uncharacterized protein LOC104226233 isoform X2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.15e-23homeobox protein 21